******************* Advanced annotation ******************* .. _Using external taxonomy database: Using a user-supplied database for taxonomic annotation ======================================================= This feature was included in version 1.7 of SqueezeMeta. Instead of using the default GenBank nr databases, the user can provide a custom database for taxonomic annotation. This database must be provide as a fasta file, with the only requirement of being compliant with GenBank taxonomy and headers. That is, the sequence headers must follow this format: :: >MBO6898974.1 [Shimia sp.] [Rhodobacteraceae bacterium] Specifying the taxa between brackets, following an (arbitrary) accession number. As in the example above, any number of taxa can be given to each of the sequences (for instance, if the database is the result of clustering a bigger database, each of the (clustered) sequences can belong to several taxa, corresponding to the members of the cluster). The script make_custom_taxdb.pl must be used to format this database for usage with SqueezeMeta, as follows: :: make_custom_taxdb.pl Then, the directory containing the new database must be specified to SqueezeMeta.pl using the ``-db`` option. This will produce taxonomic annotations using the new database. .. _Using external function database: Using external databases for functional annotation ================================================== Version 1.0 of SqueezeMeta implements the possibility of using one or several external databases (user-provided) for functional annotation. This is invoked using the ``-extdb`` option. The argument must be a file (external database file) with the following format (tab-separated fields): :: For example, we can create the file mydb.list containing information of two databases: :: DB1 /path/to/my/database1 /path/to/annotations/database1 DB2 /path/to/my/database2 /path/to/annotations/database2 and give it to SqueezeMeta using ``-extdb mydb.list``. Each database must be a fasta file of amino acid sequences, in which the sequences must have a header in the format: :: >ID|...|Function Where ID can be any identifier for the entry, and Function is the associated function that will be used for annotation. For example, a KEGG entry could be something like: :: >WP_002852319.1|K02835 MKEFILAKNEIKTMLQIMPKEGVVLQGDLASKTSLVQAWVKFLVLGLDRVDSTPTFSTQKYE... You can put anything you want between the first and last pipe, because these are the only fields that matter. For instance, the previous entry could also be: :: >WP_002852319.1|KEGGDB|27/02/2019|K02835 MKEFILAKNEIKTMLQIMPKEGVVLQGDLASKTSLVQAWVKFLVLGLDRVDSTPTFSTQKYE... Just remember not to put blank spaces, because they act as field separators in the fasta format. This database must be formatted for DIAMOND usage. For avoiding compatibility issues between different versions of DIAMOND, it is advisable that you use the DIAMOND that is shipped with SqueezeMeta, and is placed in the bin directory of SqueezeMeta distribution. You can do the formatting with the command: ``/path/to/SqueezeMeta/bin/diamond makedb -d /path/to/ext/db/dbname.dmnd --in /path/to/my/ext/dbname.fasta`` For each database, you can OPTIONALLY provide a file with functional annotations, such as the name of the enzyme or whatever you want. Its location must be specified in the last field of the external database file. It must have only two columns separated by tabulators, the first with the function, the second with the additional information. For instance: ``K02835 peptide chain release factor 1`` The ORF table (see :ref:`ORF table`) will show both the database ID and the associated annotation for each external database you provided. .. _Extra sensitive ORFs: Extra-sensitive detection of ORFs ================================= Version 1.0 implements the -D option (doublepass), that attempts to provide a more sensitive ORF detection by combining the Prodigal prediction with a BlastX search on parts of the contigs where no ORFs were predicted, or where predicted ORFs did not match anything in the taxonomic and functional databases. The procedure starts after the usual taxonomic and functional annotation. It masks the parts of the contigs in which there is a predicted ORF with some (taxonomic and functional) annotation. The remaining sequence corresponds to zones with no ORF prediction or orphan genes (no hits). The first could correspond to missed ORFs, the second to wrongly predicted ORFs. Then a DIAMOND BlastX is run only on these zones, using the same databases. The resulting hits are added as newly predicted ORFs, and the pipeline continues taking into account these new ORFs. The pros: This procedure is able to detect missing genes or correct errors in gene prediction (for example, these derived from frameshifts). For prokaryotic metagenomes, we estimate a gain of 2-3% in the number of ORFs. This method is especially useful when you suspect that gene prediction can underperform, for instance in cases in which eukaryotes and viruses are present. Prodigal is a prokaryotic gene predictor and its behaviour for other kingdoms is uncertain. In these cases, the gain can be higher than for prokaryotes. The con: Since it has to do an additional DIAMOND run (and using six frame-Blastx) it slows down the analysis, especially in the case of big and/or many metagenomes. For more details, see section :ref:`doublepass`.